PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0106s0340.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 528aa    MW: 59450.7 Da    PI: 8.9622
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0106s0340.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.21.3e-182579357
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            kRt  t+ q+ +Le+++ +++yp++e++ eLA+++gLte+q++ WF+ rR k+k+
  SapurV1A.0106s0340.1.p 25 KRTVKTPAQVIALENFYDEHKYPKEEMKSELADQIGLTEKQISSWFCHRRLKDKR 79
                            8****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-21679IPR009057Homeodomain-like
SuperFamilySSF466894.28E-171181IPR009057Homeodomain-like
PROSITE profilePS5007116.522080IPR001356Homeobox domain
SMARTSM003892.1E-172284IPR001356Homeobox domain
CDDcd000863.25E-162581No hitNo description
PfamPF000463.4E-162579IPR001356Homeobox domain
PROSITE patternPS0002705578IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MSAIFSESSE VHSEENIVSP ERNLKRTVKT PAQVIALENF YDEHKYPKEE MKSELADQIG  60
LTEKQISSWF CHRRLKDKRL KDEGYTNRRQ DRSSSILQDR GSGLRQDSCG STKQGDYRNI  120
DPREVESQRL YGQDFHTADL TYDRTSRYTG NVSGIDNISS RSSSSLQDKL VSQRQDPYDT  180
ETSKYLAQNG ASMPLIPKGA ESFGHKPSGY LKVKGEIENA AITAVKIQLG RHYKENGPPL  240
GVEFQLLPPS AFASPSRDPV NGPIYVGDLG RMHSPDVSGV RKQPGLSGRY EVYSTKMCSH  300
DSYTGGVNCN PKNGSDSHER KSRHHLEQKS TYNGSNSNAG GNSAMDMPDD LAGEMRVYKN  360
KRNYRTCSKH DFEGKRPDSL ATHHGPSGRR VNNEKIEAWL HGHDNDNPKI AQRNDYMSKP  420
SHLIHGPGKS LFTEERAPFI MTEKDEKRYG ERKRMKGSHD SVRVKRHPRD ETVVAKRFRT  480
DFSQQEHVTK ASVPGMCQRT NLTERSVMER PSSFSEDEPA ETSSSAE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024955.10.0PREDICTED: uncharacterized protein LOC105125967 isoform X1
TrEMBLU5GVF60.0U5GVF6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s28350.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-91HB-other family protein